PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G18900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family HB-PHD
Protein Properties Length: 525aa    MW: 59024.5 Da    PI: 5.2076
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G18900.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.94.1e-094364702256
                      SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +yps +++e+LA++lgLt rqV+ WF   R + +
  LPERR05G18900.1 436 YNYPSSDDKEKLAEELGLTFRQVSKWFETSRRRTR 470
                      68**************************9999887 PP

2PHD391.9e-13225279151
                      SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS.TBSSHHHHTT CS
              PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg.ewlCeeCkek 51 
                      +C+ Cg+   + +++++lCdg C + fH++Cl+++  ++++p +  w+C+ C++k
  LPERR05G18900.1 225 FCATCGSgdVTLSNDILLCDGvCIRGFHQNCLNPPMLTKDIPGDeGWICPACDCK 279
                      7******75555********77*******************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579038.64E-13215283IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.6E-12221279IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.807223279IPR019787Zinc finger, PHD-finger
PfamPF006281.5E-10225279IPR019787Zinc finger, PHD-finger
SMARTSM002494.2E-10225277IPR001965Zinc finger, PHD-type
CDDcd155043.74E-23225276No hitNo description
PROSITE patternPS013590226276IPR019786Zinc finger, PHD-type, conserved site
SMARTSM003890.001421476IPR001356Homeobox domain
SuperFamilySSF466891.75E-8436480IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-10437483IPR009057Homeodomain-like
PROSITE profilePS5007111.726438472IPR001356Homeobox domain
CDDcd000863.67E-8438470No hitNo description
PfamPF059201.3E-6438468IPR008422Homeobox KN domain
PROSITE patternPS000270447470IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MDKSTASDPV DCRGKTGNDA TSGHNRMTLK HQRLLSAPQE GENTKGARKN YRRTVNRRRN  60
DSQVLADENY FLRSSDSRIK VPFRVSAENK SPSESVHTLV QPASKRKGGS RSTKTSQDNE  120
FLKIRQRVKY ILNRMNYEQS LIEAYANEGW KGKSLGCNII SLIFITCSLE KIRPEKELER  180
AKAEILRCKL KIREEFQNLD LLLSKGKLEK SLFNSKGEIY SEDIFCATCG SGDVTLSNDI  240
LLCDGVCIRG FHQNCLNPPM LTKDIPGDEG WICPACDCKE DCIYLINEHQ GANLSMTDTW  300
EEVFPEAAAP VDDYRQIDAS DLPSEDSEDD DYVPDLLEEE DADEGSDSDD SHFVTSSDNS  360
ESSEEKETMY DFGLPFEHSE YAKSWAQSEF APGDKPGDRS NALKENTLKN LNVKQDVVLS  420
GLGKRQVQRV DYKKMYNYPS SDDKEKLAEE LGLTFRQVSK WFETSRRRTR AVVAKRSIHL  480
ENHSSKRKRS SSVESSMRVA DTDITVEKPN GSENDAATSG SGSGA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231157.11e-140PREDICTED: homeobox protein HOX1A-like isoform X1
RefseqXP_014754573.11e-140PREDICTED: homeobox protein HOX1A-like isoform X1
RefseqXP_014754575.11e-143PREDICTED: homeobox protein HOX1A-like isoform X3
SwissprotP466051e-118HOX1A_MAIZE; Homeobox protein HOX1A
TrEMBLA0A0D9WIR20.0A0A0D9WIR2_9ORYZ; Uncharacterized protein
STRINGBRADI2G19610.21e-143(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.13e-68Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain